Plant Pectate lyase 1 protein

Product Overview

• Article Name: Plant Pectate lyase 1 protein
• Biozol Catalog Number: BYT-ORB418888
• Supplier Catalog Number: orb418888
• Alternative Catalog Number: BYT-ORB418888-20,BYT-ORB418888-100,BYT-ORB418888-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Major pollen allergen Cup a 1 Allergen, Cup a 1

Product Description

This Plant Pectate lyase 1 protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 42.6 kDa
• UniProt: Q9SCG9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGG

Application Notes

• Application Notes: Biological Origin: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 22-367aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Cupressus arizonica (Arizona cypress) (Callitropsis arizonica) Pectate lyase 1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Cupressus arizonica (Arizona cypress) (Callitropsis arizonica) Pectate lyase 1.