Human C1ORF54 protein

Catalog Number: BYT-ORB418892
Article Name: Human C1ORF54 protein
Biozol Catalog Number: BYT-ORB418892
Supplier Catalog Number: orb418892
Alternative Catalog Number: BYT-ORB418892-1,BYT-ORB418892-100,BYT-ORB418892-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C1orf54Uncharacterized protein C1orf54
This Human C1ORF54 protein spans the amino acid sequence from region 17-131aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.2 kDa
UniProt: Q8WWF1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 17-131aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.