Human LMP1 protein

Product Overview

• Article Name: Human LMP1 protein
• Biozol Catalog Number: BYT-ORB418897
• Supplier Catalog Number: orb418897
• Alternative Catalog Number: BYT-ORB418897-1,BYT-ORB418897-100,BYT-ORB418897-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Protein p63

Product Description

This Human LMP1 protein spans the amino acid sequence from region 185-366aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 21.3 kDa
• UniProt: P0C741
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Application Notes

• Application Notes: Biological Origin: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). Application Notes: Tag Info: N-terminal 10xHis-taggedExpression Region: 185-366aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.