Mouse KLK14 protein

Product Overview

• Article Name: Mouse KLK14 protein
• Biozol Catalog Number: BYT-ORB418901
• Supplier Catalog Number: orb418901
• Alternative Catalog Number: BYT-ORB418901-1,BYT-ORB418901-100,BYT-ORB418901-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Glandular kallikrein KLK14

Product Description

This Mouse KLK14 protein spans the amino acid sequence from region 24-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 40.5 kDa
• UniProt: Q8CGR5
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-250aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.