Human CAMP protein

Product Overview

• Article Name: Human CAMP protein
• Biozol Catalog Number: BYT-ORB418903
• Supplier Catalog Number: orb418903
• Alternative Catalog Number: BYT-ORB418903-1,BYT-ORB418903-100,BYT-ORB418903-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 18KDA cationic antimicrobial protein

Product Description

This Human CAMP protein spans the amino acid sequence from region 132-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 24.7 kDa
• UniProt: P49913
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 132-170aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.