Bacterial PRGJ protein

Product Overview

• Article Name: Bacterial PRGJ protein
• Biozol Catalog Number: BYT-ORB418914
• Supplier Catalog Number: orb418914
• Alternative Catalog Number: BYT-ORB418914-20,BYT-ORB418914-100,BYT-ORB418914-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: prgJ, STM2872Protein PrgJ

Product Description

This Bacterial PRGJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 14.4 kDa
• UniProt: P41785
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Application Notes

• Application Notes: Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-101aaSequence Info: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgJ.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgJ.