Human KLKB1 protein

Catalog Number: BYT-ORB418915
Article Name: Human KLKB1 protein
Biozol Catalog Number: BYT-ORB418915
Supplier Catalog Number: orb418915
Alternative Catalog Number: BYT-ORB418915-1,BYT-ORB418915-100,BYT-ORB418915-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Fletcher factor Kininogenin Plasma prekallikrein
This Human KLKB1 protein spans the amino acid sequence from region 20-390aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.4 kDa
UniProt: P03952
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQEN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 20-390aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.