Bacterial APR protein

Product Overview

• Article Name: Bacterial APR protein
• Biozol Catalog Number: BYT-ORB418921
• Supplier Catalog Number: orb418921
• Alternative Catalog Number: BYT-ORB418921-20,BYT-ORB418921-100,BYT-ORB418921-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: subC, apr, Subtilisin Carlsberg, EC 3.4.21.62

Product Description

This Bacterial APR protein spans the amino acid sequence from region 106-379aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 42.0 kDa
• UniProt: P00780
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Bacillus licheniformis
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSGIVSGIEWATTNGMDVINMSLGGPSGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATY

Application Notes

• Application Notes: Biological Origin: Bacillus licheniformis. Application Notes: Tag Info: N-terminal 10xHis-SUMO-taggedExpression Region: 106-379aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus licheniformisapr.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus licheniformisapr.