E. coli FLIC protein

Catalog Number: BYT-ORB418925
Article Name: E. coli FLIC protein
Biozol Catalog Number: BYT-ORB418925
Supplier Catalog Number: orb418925
Alternative Catalog Number: BYT-ORB418925-1,BYT-ORB418925-100,BYT-ORB418925-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: fliC, flaF, hag, b1923, JW1908Flagellin
This E. coli FLIC protein spans the amino acid sequence from region 2-498aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 67.2 kDa
UniProt: P04949
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTV
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-498aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.