Bacterial RPLV protein

Catalog Number: BYT-ORB418927
Article Name: Bacterial RPLV protein
Biozol Catalog Number: BYT-ORB418927
Supplier Catalog Number: orb418927
Alternative Catalog Number: BYT-ORB418927-1,BYT-ORB418927-100,BYT-ORB418927-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: rplV, APH_0285, 50S ribosomal protein L22
This Bacterial RPLV protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 17.2 kDa
UniProt: Q2GL54
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Anaplasma phagocytophilum (strain HZ)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER
Application Notes: Biological Origin: Anaplasma phagocytophilum (strain HZ). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal MYC-taggedExpression Region: 1-112aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.