Bacterial HSPX protein

Catalog Number: BYT-ORB418929
Article Name: Bacterial HSPX protein
Biozol Catalog Number: BYT-ORB418929
Supplier Catalog Number: orb418929
Alternative Catalog Number: BYT-ORB418929-1,BYT-ORB418929-100,BYT-ORB418929-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 16KDA antigen HSP 16.3
This Bacterial HSPX protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 18.1 kDa
UniProt: P0A5B8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Application Notes: Biological Origin: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 2-144aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.