Mouse CLEC4A protein

Product Overview

• Article Name: Mouse CLEC4A protein
• Biozol Catalog Number: BYT-ORB418938
• Supplier Catalog Number: orb418938
• Alternative Catalog Number: BYT-ORB418938-1,BYT-ORB418938-100,BYT-ORB418938-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: C-type lectin superfamily member 6 Dendritic cell immunoreceptor

Product Description

This Mouse CLEC4A protein spans the amino acid sequence from region 70-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 39.6 kDa
• UniProt: Q9QZ15
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 70-238aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.