Human CLDN3 protein

Catalog Number: BYT-ORB418939
Article Name: Human CLDN3 protein
Biozol Catalog Number: BYT-ORB418939
Supplier Catalog Number: orb418939
Alternative Catalog Number: BYT-ORB418939-1,BYT-ORB418939-100,BYT-ORB418939-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Clostridium perfringens enterotoxin receptor 2
This Human CLDN3 protein spans the amino acid sequence from region 30-80aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.7 kDa
UniProt: O15551
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 30-80aaSequence Info: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.