Bacterial RELG protein

Catalog Number: BYT-ORB418945
Article Name: Bacterial RELG protein
Biozol Catalog Number: BYT-ORB418945
Supplier Catalog Number: orb418945
Alternative Catalog Number: BYT-ORB418945-1,BYT-ORB418945-100,BYT-ORB418945-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Putative endoribonuclease RelG
This Bacterial RELG protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 26.2 kDa
UniProt: O33348
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR
Application Notes: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-87aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.