Human SPRR2B protein

Product Overview

• Article Name: Human SPRR2B protein
• Biozol Catalog Number: BYT-ORB418950
• Supplier Catalog Number: orb418950
• Alternative Catalog Number: BYT-ORB418950-1,BYT-ORB418950-100,BYT-ORB418950-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: SPRR2B, Small proline-rich protein 2B, SPR-2B

Product Description

This Human SPRR2B protein spans the amino acid sequence from region 1-72aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 12 kDa
• UniProt: P35325
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-72aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.