Mouse LY6C1 protein

Catalog Number: BYT-ORB418980
Article Name: Mouse LY6C1 protein
Biozol Catalog Number: BYT-ORB418980
Supplier Catalog Number: orb418980
Alternative Catalog Number: BYT-ORB418980-20,BYT-ORB418980-100,BYT-ORB418980-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ly6c1, Lymphocyte antigen 6C1, Ly-6C1
This Mouse LY6C1 protein spans the amino acid sequence from region 27-109aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 11.1 kDa
UniProt: P0CW02
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 27-109aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ly6c1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ly6c1.