Bacterial ADK protein

Product Overview

• Article Name: Bacterial ADK protein
• Biozol Catalog Number: BYT-ORB418998
• Supplier Catalog Number: orb418998
• Alternative Catalog Number: BYT-ORB418998-20,BYT-ORB418998-100,BYT-ORB418998-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: ATP-AMP transphosphorylase ATP, AMP phosphotransferase Adenylate monophosphate kinase

Product Description

This Bacterial ADK protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 36.1 kDa
• UniProt: A5U0B9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK

Application Notes

• Application Notes: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-181aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) adk.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) adk.