Bacterial PYRG protein
Catalog Number:
BYT-ORB419004
- Images (3)
| Article Name: | Bacterial PYRG protein |
| Biozol Catalog Number: | BYT-ORB419004 |
| Supplier Catalog Number: | orb419004 |
| Alternative Catalog Number: | BYT-ORB419004-20,BYT-ORB419004-100,BYT-ORB419004-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Cytidine 5-triphosphate synthase Cytidine triphosphate synthetase |
| This Bacterial PYRG protein spans the amino acid sequence from region 1-267aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 49.6 kDa |
| UniProt: | P65925 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Streptococcus pyogenes serotype M1 |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIKNKLAQFCDVNSEAVIESRDVEHLYQIPLNLQAQ |
| Application Notes: | Biological Origin: Streptococcus pyogenes serotype M1. Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-267aaSequence Info: Partial |



