Mouse Ripk1 protein

Product Overview

• Article Name: Mouse Ripk1 protein
• Biozol Catalog Number: BYT-ORB419042
• Supplier Catalog Number: orb419042
• Alternative Catalog Number: BYT-ORB419042-1,BYT-ORB419042-100,BYT-ORB419042-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cell death protein RIP Receptor-interacting protein 1

Product Description

This Mouse Ripk1 protein spans the amino acid sequence from region 1-656aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 88 kDa
• UniProt: Q60855
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNVEEILE

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 1-656aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ripk1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ripk1.