Bacterial RPLL protein

Product Overview

• Article Name: Bacterial RPLL protein
• Biozol Catalog Number: BYT-ORB419044
• Supplier Catalog Number: orb419044
• Alternative Catalog Number: BYT-ORB419044-1,BYT-ORB419044-100,BYT-ORB419044-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: rplL, M6_Spy0814, 50S ribosomal protein L7/L12

Product Description

This Bacterial RPLL protein spans the amino acid sequence from region 1-121aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 32.3 kDa
• UniProt: Q5XCB4
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK

Application Notes

• Application Notes: Biological Origin: Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-121aaSequence Info: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) rplL.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) rplL.