Bacterial LUKF protein

Product Overview

• Article Name: Bacterial LUKF protein
• Biozol Catalog Number: BYT-ORB419046
• Supplier Catalog Number: orb419046
• Alternative Catalog Number: BYT-ORB419046-1,BYT-ORB419046-100,BYT-ORB419046-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Gamma-hemolysin, H-gamma-I subunit

Product Description

This Bacterial LUKF protein spans the amino acid sequence from region 26-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 54 kDa
• UniProt: P31715
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Staphylococcus aureus
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRW

Application Notes

• Application Notes: Biological Origin: Staphylococcus aureus. Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 26-323aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureuslukF.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureuslukF.