Human OXT protein

Catalog Number: BYT-ORB419047
Article Name: Human OXT protein
Biozol Catalog Number: BYT-ORB419047
Supplier Catalog Number: orb419047
Alternative Catalog Number: BYT-ORB419047-1,BYT-ORB419047-100,BYT-ORB419047-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ocytocin
This Human OXT protein spans the amino acid sequence from region 32-125aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.6 kDa
UniProt: P01178
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 32-125aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) OXT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) OXT.