Rat CD300LF protein

Product Overview

• Article Name: Rat CD300LF protein
• Biozol Catalog Number: BYT-ORB419068
• Supplier Catalog Number: orb419068
• Alternative Catalog Number: BYT-ORB419068-1,BYT-ORB419068-100,BYT-ORB419068-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CD300 antigen-like family member F CD_antigen, CD300f

Product Description

This Rat CD300LF protein spans the amino acid sequence from region 19-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 38.3 kDa
• UniProt: Q566E6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Rattus norvegicus (Rat)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS

Application Notes

• Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 19-181aaSequence Info: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Cd300lf.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Cd300lf.