E. coli ALKB protein

Product Overview

• Article Name: E. coli ALKB protein
• Biozol Catalog Number: BYT-ORB419070
• Supplier Catalog Number: orb419070
• Alternative Catalog Number: BYT-ORB419070-1,BYT-ORB419070-100,BYT-ORB419070-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Alkylated DNA repair protein AlkB DNA oxidative demethylase AlkB

Product Description

This E. coli ALKB protein spans the amino acid sequence from region 1-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 44.1 kDa
• UniProt: P05050
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli (strain K12)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE

Application Notes

• Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-216aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) alkB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) alkB.