Rat HSD17B10 protein

Product Overview

• Article Name: Rat HSD17B10 protein
• Biozol Catalog Number: BYT-ORB419101
• Supplier Catalog Number: orb419101
• Alternative Catalog Number: BYT-ORB419101-1,BYT-ORB419101-100,BYT-ORB419101-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 17-beta-hydroxysteroid dehydrogenase 10

Product Description

This Rat HSD17B10 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 29.1 kDa
• UniProt: O70351
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Rattus norvegicus (Rat)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGA

Application Notes

• Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 2-261aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Hsd17b10.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Hsd17b10.