Rat HSD17B10 protein
Catalog Number:
BYT-ORB419101
- Images (3)
| Article Name: | Rat HSD17B10 protein |
| Biozol Catalog Number: | BYT-ORB419101 |
| Supplier Catalog Number: | orb419101 |
| Alternative Catalog Number: | BYT-ORB419101-1,BYT-ORB419101-100,BYT-ORB419101-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | 17-beta-hydroxysteroid dehydrogenase 10 |
| This Rat HSD17B10 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 29.1 kDa |
| UniProt: | O70351 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Rattus norvegicus (Rat) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGA |
| Application Notes: | Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 2-261aaSequence Info: Full Length |



