Human CHRM3 protein

Product Overview

• Article Name: Human CHRM3 protein
• Biozol Catalog Number: BYT-ORB419104
• Supplier Catalog Number: orb419104
• Alternative Catalog Number: BYT-ORB419104-1,BYT-ORB419104-100,BYT-ORB419104-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: AChR, ACM3_HUMAN, cholinergic receptor muscarinic 3, CHRM 3, CHRM3, EGBRS, HM 3, HM3, m3 muscarinic acetylcholine receptor, M3 muscarinic receptor, muscarinic 3, Muscarinic acetylcholine receptor M3, muscarinic cholinergic m3 receptor, muscarinic m3 receptor

Product Description

This Human CHRM3 protein spans the amino acid sequence from region 253-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 40.7 kDa
• UniProt: P20309
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 253-492aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRM3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRM3.