Human CHRM3 protein

Catalog Number: BYT-ORB419104
Article Name: Human CHRM3 protein
Biozol Catalog Number: BYT-ORB419104
Supplier Catalog Number: orb419104
Alternative Catalog Number: BYT-ORB419104-1,BYT-ORB419104-100,BYT-ORB419104-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: AChR, ACM3_HUMAN, cholinergic receptor muscarinic 3, CHRM 3, CHRM3, EGBRS, HM 3, HM3, m3 muscarinic acetylcholine receptor, M3 muscarinic receptor, muscarinic 3, Muscarinic acetylcholine receptor M3, muscarinic cholinergic m3 receptor, muscarinic m3 rece
Recombinant Human Muscarinic acetylcholine receptor M3
Molecular Weight: 40.7 kDa
UniProt: P20309
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
Application Notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 253-492aaSequence Info: Full Length