Bacterial HLGB protein

Catalog Number: BYT-ORB419110
Article Name: Bacterial HLGB protein
Biozol Catalog Number: BYT-ORB419110
Supplier Catalog Number: orb419110
Alternative Catalog Number: BYT-ORB419110-1,BYT-ORB419110-100,BYT-ORB419110-20,BYT-ORB419110-500
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Bacteria
Alternative Names: H-gamma-1 H-gamma-I
Recombinant Staphylococcus aureus Gamma-hemolysin component B
Molecular Weight: 36.1 kDa
UniProt: P0A075
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus (strain N315)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQ
Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 26-325aaSequence Info: Full Length