Human SLC4A1 protein
Catalog Number:
BYT-ORB419140
- Images (3)
| Article Name: | Human SLC4A1 protein |
| Biozol Catalog Number: | BYT-ORB419140 |
| Supplier Catalog Number: | orb419140 |
| Alternative Catalog Number: | BYT-ORB419140-1,BYT-ORB419140-100,BYT-ORB419140-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Anion exchange protein 1 |
| This Human SLC4A1 protein spans the amino acid sequence from region 1-403aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 50.3 kDa |
| UniProt: | P02730 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEA |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-403aaSequence Info: Partial |



