Human Major capsid protein VP1 protein

Catalog Number: BYT-ORB419142
Article Name: Human Major capsid protein VP1 protein
Biozol Catalog Number: BYT-ORB419142
Supplier Catalog Number: orb419142
Alternative Catalog Number: BYT-ORB419142-1,BYT-ORB419142-100,BYT-ORB419142-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Major structural protein VP1
This Human Major capsid protein VP1 protein spans the amino acid sequence from region 1-362aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 45.1 kDa
UniProt: P03088
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: BK polyomavirus (BKPyV) (Human polyomavirus 1)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAPTKRKGECPGAAPKKPKEPVQVPKLLIKGGVEVLEVKTGVDAITEVECFLNPEMGDPDENLRGFSLKLSAENDFSSDSPERKMLPCYSTARIPLPNLNEDLTCGNLLMWEAVTVQTEVIGITSMLNLHAGSQKVHEHGGGKPIQGSNFHFFAVGGEPLEMQGVLMNYRSKYPDGTITPKNPTAQSQVMNTDHKAYLDKNNAYPVECWVPDPSRNENARYFGTFTGGENVPPVLHVTNTATTVLLDEQGVGPLC
Application Notes: Biological Origin: BK polyomavirus (BKPyV) (Human polyomavirus 1). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-362aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed BK polyomavirus (BKPyV) (Human polyomavirus 1).
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed BK polyomavirus (BKPyV) (Human polyomavirus 1).