Mouse WNT7B protein

Product Overview

• Article Name: Mouse WNT7B protein
• Biozol Catalog Number: BYT-ORB419181
• Supplier Catalog Number: orb419181
• Alternative Catalog Number: BYT-ORB419181-1,BYT-ORB419181-100,BYT-ORB419181-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Wnt-7b

Product Description

This Mouse WNT7B protein spans the amino acid sequence from region 25-349aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 56.3 kDa
• UniProt: P28047
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCE

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 25-349aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Wnt7b.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Wnt7b.

SDS-analysis of Mouse WNT7B protein.

Line graph illustrates about the Ag-Ab reactions using different concentrations of