Rat XCL1 protein

Product Overview

• Article Name: Rat XCL1 protein
• Biozol Catalog Number: BYT-ORB419316
• Supplier Catalog Number: orb419316
• Alternative Catalog Number: BYT-ORB419316-100,BYT-ORB419316-5,BYT-ORB419316-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: C motif chemokine 1, Small-inducible cytokine C1

Product Description

This Rat XCL1 protein spans the amino acid sequence from region 22-114aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 10.0 kDa
• UniProt: P51672
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Source: Rattus norvegicus (Rat)
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG

Application Notes

• Application Notes: Biological Origin: Rattus norvegicus (Rat). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of > 1.0 x 10 4 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 22-114aaSequence Info: Full Length of Mature Protein

Images

orb419316

orb419316