Human IL12A protein

Product Overview

• Article Name: Human IL12A protein
• Biozol Catalog Number: BYT-ORB419321
• Supplier Catalog Number: orb419321
• Alternative Catalog Number: BYT-ORB419321-10,BYT-ORB419321-100,BYT-ORB419321-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: IL-12A, CLMF p35, IL-12 subunit p35, NK cell stimulatory factor chain 1, NKSF1

Product Description

This Human IL12A protein spans the amino acid sequence from region 23-219aa&23-328aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value.
• UniProt: P29460
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Source: Homo sapiens (Human)
• Purity: > 95% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: p35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGI

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 * 107 IU/mg. Application Notes: Tag Info: NO-taggedExpression Region: 23-219aa&23-328aaSequence Info: Partial

Images

orb419321

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.