Viral Matrix protein 1 protein

Product Overview

• Article Name: Viral Matrix protein 1 protein
• Biozol Catalog Number: BYT-ORB419328
• Supplier Catalog Number: orb419328
• Alternative Catalog Number: BYT-ORB419328-1,BYT-ORB419328-100,BYT-ORB419328-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: M, Matrix protein 1, M1

Product Description

This Viral Matrix protein 1 protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 32.8 kDa
• UniProt: A4GCL0
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Influenza A virus (strain A/USA:Iowa/1943 H1N1)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

Application Notes

• Application Notes: Biological Origin: Influenza A virus (strain A/USA:Iowa/1943 H1N1). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-252aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/USA: Iowa/1943 H1N1) M.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/USA: Iowa/1943 H1N1) M.