Human Vitamin D-binding protein protein

Product Overview

• Article Name: Human Vitamin D-binding protein protein
• Biozol Catalog Number: BYT-ORB419330
• Supplier Catalog Number: orb419330
• Alternative Catalog Number: BYT-ORB419330-1,BYT-ORB419330-100,BYT-ORB419330-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Gc protein-derived macrophage activating factor

Product Description

This Human Vitamin D-binding protein protein spans the amino acid sequence from region 19-474aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 67 kDa
• UniProt: P02774
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDC

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 19-474aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GC.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GC.