Human Protein E7 protein

Product Overview

• Article Name: Human Protein E7 protein
• Biozol Catalog Number: BYT-ORB419332
• Supplier Catalog Number: orb419332
• Alternative Catalog Number: BYT-ORB419332-1,BYT-ORB419332-100,BYT-ORB419332-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: E7, Protein E7

Product Description

This Human Protein E7 protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 15.1 kDa
• UniProt: P03129
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human papillomavirus type 16
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Application Notes

• Application Notes: Biological Origin: Human papillomavirus type 16. Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-98aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E7.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E7.