Human Fusion glycoprotein F0 protein

Product Overview

• Article Name: Human Fusion glycoprotein F0 protein
• Biozol Catalog Number: BYT-ORB419334
• Supplier Catalog Number: orb419334
• Alternative Catalog Number: BYT-ORB419334-1,BYT-ORB419334-100,BYT-ORB419334-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: F, Fusion glycoprotein F0, Protein F) [Cleaved into, Fusion glycoprotein F2, Interchain peptide, Fusion glycoprotein F2, Fusion glycoprotein F1]

Product Description

This Human Fusion glycoprotein F0 protein spans the amino acid sequence from region 27-529aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 69.9 kDa
• UniProt: P03420
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human respiratory syncytial virus A (strain A2)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIV

Application Notes

• Application Notes: Biological Origin: Human respiratory syncytial virus A (strain A2). Application Notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 27-529aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain A2) F.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain A2) F.