Human Fusion glycoprotein F0 protein

Catalog Number: BYT-ORB419341
Article Name: Human Fusion glycoprotein F0 protein
Biozol Catalog Number: BYT-ORB419341
Supplier Catalog Number: orb419341
Alternative Catalog Number: BYT-ORB419341-1,BYT-ORB419341-100,BYT-ORB419341-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FFusion glycoprotein F0 [Cleaved into, Fusion glycoprotein F2, Interchain peptide, Fusion glycoprotein F2, Fusion glycoprotein F1]
This Human Fusion glycoprotein F0 protein spans the amino acid sequence from region 27-529aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 60.8 kDa
UniProt: P11209
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human respiratory syncytial virus A (strain RSS-2)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKSAVTELQLLMQSTPATNNRARRELPRFMNYTLNNTKNTNVTLSKKRKRRFLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIV
Application Notes: Biological Origin: Human respiratory syncytial virus A (strain RSS-2). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 27-529aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain RSS-2) F.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain RSS-2) F.