Viral Nucleoprotein protein

Product Overview

• Article Name: Viral Nucleoprotein protein
• Biozol Catalog Number: BYT-ORB419345
• Supplier Catalog Number: orb419345
• Alternative Catalog Number: BYT-ORB419345-1,BYT-ORB419345-100,BYT-ORB419345-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Nucleocapsid protein

Product Description

This Viral Nucleoprotein protein spans the amino acid sequence from region 488-739aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 31.1 kDa
• UniProt: P18272
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Application Notes

• Application Notes: Biological Origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 488-739aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) NP.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) NP.