Mouse Vitamin D-binding protein

Product Overview

• Article Name: Mouse Vitamin D-binding protein
• Biozol Catalog Number: BYT-ORB419347
• Supplier Catalog Number: orb419347
• Alternative Catalog Number: BYT-ORB419347-1,BYT-ORB419347-100,BYT-ORB419347-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Gc-globulin Group-specific component

Product Description

This Mouse Vitamin D-binding protein spans the amino acid sequence from region 17-476aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53 kDa
• UniProt: P21614
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LERGRDYEKDKVCNELAMLGKEDFRSLSLILYSRKFSSSTFEQVNQLVKEVVSLTEECCAEGADPTCYDTRTSELSVKSCESDAPFPVHPGTPECCTKEGLERKLCMAALSHQPQEFPTYVEPTNDEICEAFRRDPKGFADQFLYEYSSNYGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCFVKERLQMKHLSLLTTMSNRVCSQYAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCCESTSE

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 17-476aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of Gc was greater than 95% as determined by SEC-HPLC