Human TIMM8A protein

Catalog Number: BYT-ORB54425
Article Name: Human TIMM8A protein
Biozol Catalog Number: BYT-ORB54425
Supplier Catalog Number: orb54425
Alternative Catalog Number: BYT-ORB54425-1,BYT-ORB54425-100,BYT-ORB54425-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Deafness dystonia protein 1 X-linked deafness dystonia protein
Recombinant human TIMM8A protein
Molecular Weight: 38 kDa
UniProt: O60220
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-350AA: 1-97AAFull Length : Full Length