Human MARCKSL1 protein

Catalog Number: BYT-ORB54433
Article Name: Human MARCKSL1 protein
Biozol Catalog Number: BYT-ORB54433
Supplier Catalog Number: orb54433
Alternative Catalog Number: BYT-ORB54433-1,BYT-ORB54433-100,BYT-ORB54433-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate
Recombinant human MARCKSL1 protein
Molecular Weight: 46.5 kDa
UniProt: P49006
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
Application Notes: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal GST-tagged1-307AA: 1-195AAFull Length of Isoform 2 : Full Length of BC066915