Human MPI protein

Catalog Number: BYT-ORB54434
Article Name: Human MPI protein
Biozol Catalog Number: BYT-ORB54434
Supplier Catalog Number: orb54434
Alternative Catalog Number: BYT-ORB54434-1,BYT-ORB54434-100,BYT-ORB54434-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Phosphohexomutase Phosphomannose isomerase
Recombinant human MPI protein
Molecular Weight: 73.5 kDa
UniProt: P34949
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIY
Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-195AA: 1-423AAFull Length of BC066915 : Full Length