Mouse Masp2 protein

Catalog Number: BYT-ORB54602
Article Name: Mouse Masp2 protein
Biozol Catalog Number: BYT-ORB54602
Supplier Catalog Number: orb54602
Alternative Catalog Number: BYT-ORB54602-1,BYT-ORB54602-100,BYT-ORB54602-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2
This Mouse Masp2 protein spans the amino acid sequence from region 20-685aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 77.4 kDa
UniProt: Q91WP0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SKWPEPVFGRLVSPGFPEKYADHQDRSWTLTAPPGYRLRLYFTHFDLELSYRCEYDFVKLSSGTKVLATLCGQESTDTEQAPGNDTFYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAEDVDECRVSLGDSVPCDHYCHNYLGGYYCSCRAGYVLHQNKHTCSALCSGQVFTGRSGYLSSPEYPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQTDKGEHGPFCGKTLPPRIETDSHKV
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-tagged1-397AA: 20-685AAFull Length: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Masp2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Masp2.