Human AADAC protein

Product Overview

• Article Name: Human AADAC protein
• Biozol Catalog Number: BYT-ORB54620
• Supplier Catalog Number: orb54620
• Alternative Catalog Number: BYT-ORB54620-1,BYT-ORB54620-100,BYT-ORB54620-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: AAAD_HUMAN, Aada, Aadac, Arylacetamide deacetylase (esterase), Arylacetamide deacetylase, CES5A1, DAC

Product Description

This Human AADAC protein spans the amino acid sequence from region 24-399aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 63.1 kDa
• UniProt: P22760
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLF

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged551-919AA: 24-399AAPartial: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AADAC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AADAC.