Bacterial caf1 protein

Product Overview

• Article Name: Bacterial caf1 protein
• Biozol Catalog Number: BYT-ORB54637
• Supplier Catalog Number: orb54637
• Alternative Catalog Number: BYT-ORB54637-1,BYT-ORB54637-100,BYT-ORB54637-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

Product Description

This Bacterial caf1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 17.6 kDa
• UniProt: P26948
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yersinia pestis
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Application Notes

• Application Notes: Biological Origin: Yersinia pestis. Application Notes: N-terminal 10xHis-tagged: N-terminal 6xHis-tagged185-366AA: 22-170AAPartial: Full length of mature protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Yersinia pestiscaf1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Yersinia pestiscaf1.