Human TARDBP protein

Catalog Number: BYT-ORB54647
Article Name: Human TARDBP protein
Biozol Catalog Number: BYT-ORB54647
Supplier Catalog Number: orb54647
Alternative Catalog Number: BYT-ORB54647-1,BYT-ORB54647-100,BYT-ORB54647-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, TDP-43
This Human TARDBP protein spans the amino acid sequence from region 1-396aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.9 kDa
UniProt: Q13148
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged2-391AA: 1-396AAPartial : Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of TARDBP was greater than 95% as determined by SEC-HPLC