Human FBXW7 protein

Product Overview

• Article Name: Human FBXW7 protein
• Biozol Catalog Number: BYT-ORB54702
• Supplier Catalog Number: orb54702
• Alternative Catalog Number: BYT-ORB54702-100,BYT-ORB54702-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Archipelago homolog1 Publication Short name, hAgo1 Publication F-box and WD-40 domain-containing protein 7Curated F-box protein FBX301 Publication SEL-101 Publication hCdc4

Product Description

This Human FBXW7 protein spans the amino acid sequence from region 1-707aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 83.7 kDa
• UniProt: Q969H0
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDE

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged22-196AA: 1-707AAFull Length : Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FBXW7.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FBXW7.