human DSG1 protein

Product Overview

• Article Name: human DSG1 protein
• Biozol Catalog Number: BYT-ORB54740
• Supplier Catalog Number: orb54740
• Alternative Catalog Number: BYT-ORB54740-100,BYT-ORB54740-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cadherin family member 4 Desmosomal glycoprotein 1

Product Description

This human DSG1 protein spans the amino acid sequence from region 50-548aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 60.4 kDa
• UniProt: Q02413
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: EWIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFSANWM

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged50-548AA: 50-548AAExtracellular Domain: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DSG1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DSG1.