human FAM167A protein

Product Overview

• Article Name: human FAM167A protein
• Biozol Catalog Number: BYT-ORB54760
• Supplier Catalog Number: orb54760
• Alternative Catalog Number: BYT-ORB54760-1,BYT-ORB54760-100,BYT-ORB54760-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: FAM167A, C8orf13Protein FAM167A

Product Description

This human FAM167A protein spans the amino acid sequence from region 1-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 28.2 kDa
• UniProt: Q96KS9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal FC-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged1-153AA: 1-214AAFull Length: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) FAM167A.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) FAM167A.