SEPT11 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SEPT11 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB55705
• Supplier Catalog Number: orb55705
• Alternative Catalog Number: BYT-ORB55705-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11)
• Conjugation: Unconjugated
• Alternative Names: 45180

Product Description

Rabbit polyclonal antibody to SEPT11 .

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 49kDa
• NCBI: 060713
• UniProt: Q9NVA2
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET
• Target: SEPT11

Images

Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SEPT11(septin 11) antibody (orb55705).

SEPT11 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb55705 with 1:200 dilution. Western blot was performed using orb55705 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SEPT11 IP with orb55705 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-SEPT11(septin 11) Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.